Sermorelin(GHRH) is a bio-identical hormone that has recently been genetically engineered to stimulate the secretion of Growth Hormone Releasing Hormone (GHRH) from the hypothalamus, a gland adjacent to the pituitary gland.GHRH is a peptide that contains the first 29 amino acids of our own GH.
Sermorelin
$80.00 $65.00
QTY Discount Price
Kits | 1 -2 | 3 -5 | 6 -10 | 11 -15 | 16 + |
---|---|---|---|---|---|
Price | $65.00 | $63.05 | $61.75 | $59.80 | $58.50 |
Description
Sermorelin(GHRH) is a bio-identical hormone that has recently been genetically engineered to stimulate the secretion of Growth Hormone Releasing Hormone (GHRH) from the hypothalamus, a gland adjacent to the pituitary gland.GHRH is a peptide that contains the first 29 amino acids of our own GH. These 29 amino acids are the active amino acids of GHRH. It is GHRH that stimulates the pituitary glands to release GH.As we get older,the hormones produced by the anterior pituitary are depleted. It has now been shown that GHRH can restore the GH-RNA to a youthful level causing elevation of levels of IGF-1.
Catalogue Number:L648976
Synonyms:Sermorelin Acetate
CAS NO.:86168-78-7
Molecular Formula:C149H246N44O42S
Molecular Weight:3357.88
Peptide purity: > 98.0%
Appearance: White powder
Related substance: Total Impurities(%) ≤ 2.0%
Acetate content: ≤ 15.0%
Bacterial Endotoxins: ≤5 IU/mg
Sequence:H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
One Letter Sequence:YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2
Source:Chemical Synthesis
Reconstitution : As a general procedure, the manufacturer recommends reconstituting PT-141 peptides in sterile, distilled water, with light sonication if necessary.
Storage for Sermorelin:Lyophilized SERMORELIN although stable at room temperature for 3 weeks,should be stored desiccated below -18°C.Upon reconstitution FST should be stored at 4°C between 2-7 days and for future use below -18°C.
CAUTION:Any questions about Sermorelin peptide usage including,but not limited to bodybuilding, dosing, injections or cycling will be added to our DO NOT SELL LIST.This product is NOT intended to prevent, treat, or cure disease conditions or to affect the structure or function of the body. The sale of this product is restricted to research applications ONLY. This product is NOT for human consumption. This product can be harmful if ingested.
Additional information
Weight | 0.08 kg |
---|---|
Dimensions | 25 × 20 × 7 cm |
Packing | 2mg/vial, 10vials/kit |
8 reviews for Sermorelin
You must be logged in to post a review.
Eliezer Galvan –
Amazing how clean and precise . Very happy . Look forward to next transaction.
Wade Alvarado –
have yet to try product yet
Stephanie Phelps –
excellent quality and service
Houston Bolton –
Ordering was quick and easy. Product was shipped fast (received 8 days after order was placed) and Bruce was great with answering questions.
Randal Cain –
Excellent company to do business with! Great communication through entire process! Product arrived on time and was as described! Definitely going to do business with them again!
Khloe Flowers –
excellent and happy with the quality
Annalise Castaneda –
Friendly, knowledgeable staff, willing to work with me to customize my order. Appears to be high quality goods. Very smooth transaction. Would absolutely recommend!
Maxine Lawrence –
really good products